Towards Native Structural Reasoning withSciReasoner

The trace frames the task as mapping sequence plus predicted 3D structure to GO biological process terms. It starts from the 3Di representation, looking for residue-level geometry that indicates the fold class before mapping that fold to function.

It cites helical structural strings such as V V L L V V C L V V V V L V V and V V V V V V D, treating them as evidence for a helical/globular scaffold. Mixed regions such as D F E E E E A C L V F P L N are interpreted as loop or coil connectors.

The sequence side then supplies motif evidence. The trace points to glycine-rich and charged-residue stretches, including the long segment around VGGNCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGARH..., as sequence evidence linked to amino acid biosynthesis. Combining the helical/globular scaffold and motifs, it predicts aspartate family amino acid biosynthesis, lysine biosynthesis via diaminopimelate, methionine and threonine related processes.

The trace first partitions the product into two domains connected by a propyl chain. Domain A is described as a thienopyridine ring system with acetyl and methyl substitution; Domain B is a piperidine ring substituted by a fluorinated benzisoxazole group.

It then chooses the strategic bond: the C-N bond between [CH2:1] and [N:28]. This gives a classic alkylation disconnection where the propyl chain becomes the electrophile and the piperidine nitrogen becomes the nucleophile.

The proposed reactants are an alkyl chloride, Cl-CH2-CH2-CH2-Domain A, and a secondary piperidine, Domain B-NH. The sanity check argues that the piperidine nitrogen is the most nucleophilic site and that the amide nitrogen in Domain A is less competitive because of delocalization.

To determine the shear modulus for this material, I first need to decode the structural information provided in the SLICES string to understand the bonding environment and symmetry. The input string begins with the space group encoding <material_structure>o w b OOO m OOO c OOO o</material_structure>, which defines the crystallographic symmetry and unit cell constraints for the calculation. Following the symmetry tokens, I examine the atom list <material_structure>Ag Ag Hg I I I I</material_struc...

Next, I analyze the edge list to determine the coordination geometry, which is critical for estimating mechanical properties. I observe connections such as <material_structure>0 6 -oo</material_structure> and <material_structure>0 3 -oo</material_structure>, which indicate that the first silver atom (index 0) forms bonds with iodine atoms (indices 3 and 6) across periodic boundaries. Similarly, the mercury atom at index 2 shows connections like <material_structure>2 3 --o</material_structure> an...

Considering the heavy atomic masses of silver and mercury combined with the relatively large and polarizable iodine anions, the lattice is expected to be relatively compliant compared to oxide or fluoride counterparts. The specific arrangement of bonds, including intra-cell links like <material_structure>0 5 ooo</material_structure> and inter-cell shifts like <material_structure>1 4 o-o</material_structure>, creates a rigid but heavy framework. Based on the structural features identified—specifi...

To determine the bandgap of this material, I first need to decode the structural information provided in the SLICES string to understand the crystallographic environment and bonding topology. The space group encoding <material_structure>+ z o</material_structure> corresponds to the P-1 space group (number 2), which indicates a triclinic crystal system with inversion symmetry. This low symmetry is significant because it removes degeneracies that might otherwise widen or narrow the bandgap, allowi...

Next, I examine the atom list to establish the stoichiometry and identify the constituent elements. The list begins with <material_structure>Cd Cd</material_structure>, confirming the presence of two cadmium atoms per unit cell, followed by a large number of hydrogen and carbon atoms, and ending with <material_structure>N N N N O O O O O O O O</material_structure>. This composition matches the chemical formula Cd2C44H32N4O8, identifying the material as a cadmium-based coordination polymer or met...

To understand the electronic coupling, I analyze the edge list to see how the cadmium atoms interact with the ligands. The cadmium atom at index 0 forms bonds such as <material_structure>0 78 ooo</material_structure> and <material_structure>0 86 ooo</material_structure>. By cross-referencing the atom indices, I determine that index 78 corresponds to a nitrogen atom and index 86 corresponds to an oxygen atom, indicating that the cadmium centers are coordinated by both nitrogen and oxygen donors....

To determine the band gap of this material, I first need to decode the structural information provided in the SLICES string to understand the chemical environment and bonding topology. The input string begins with the space group encoding <material_structure>o x b OOO j OOO o</material_structure>, which defines the symmetry operations, followed immediately by the atom list. Reading the atom symbols in order, I see <material_structure>Ba La Fe Fe Cu Cu O O O O O O O O O O O</material_structure>....

My primary focus for predicting the electronic property is the transition metal sublattice, specifically the Iron and Copper sites, which correspond to indices 2, 3, 4, and 5 in the atom list. I need to examine the bonding environment to see how these metals interact with the oxygen ligands. Scanning the edge list, I find connections such as <material_structure>2 6 ooo</material_structure> and <material_structure>2 14 ooo</material_structure>, which indicate that the Iron atom at index 2 is bond...

Crucially, I observe that the Oxygen sites are not isolated; they act as bridges connecting the different metal centers. For instance, Oxygen site 14 is connected to both Iron (index 2 via <material_structure>2 14 ooo</material_structure>) and Copper (index 1 via <material_structure>1 14 ooo</material_structure>), creating a Fe-O-Cu pathway. This heteroatomic networking allows for significant orbital overlap between the transition metal d-orbitals and the oxygen p-orbitals. In materials containi...

To determine the appropriate Gene Ontology biological process annotations for this protein, I need to analyze the relationship between its amino acid sequence and its predicted three-dimensional structure. The core task is to infer function from form, specifically looking for structural motifs that indicate a particular cellular role. I will start by examining the structural representation to classify the protein's fold, as the fold is often the strongest predictor of biological function when ho...

First, I assess the secondary structure content by scanning the 3Di structural tag for characteristic patterns. According to the decoding rules, runs of V and L correspond to alpha-helices, while runs of D, P, and A indicate beta-strands. Scanning the beginning of the structure, I observe a segment <protein_structure>D F P D D P D Q K T K D K K K K W K F K F K D W P D Q Q P L E D P G G G T F T K M K I K M K M W G D P D P F K I K I W I W M W I A T P P D D P P P C R C P P T D T Q D T K I W M G G H...

Next, I correlate this structural insight with the amino acid sequence to understand the protein's environment. Beta-rich structures, particularly those forming barrels, are frequently found in outer membranes of bacteria or as soluble binding domains in transport systems. Looking at the sequence, I see a mix of polar and non-polar residues that would support such a localization. For example, the segment GNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPE...

To determine the appropriate Gene Ontology biological process terms for this protein, I need to analyze the relationship between its amino acid sequence and its predicted three-dimensional structure. The core task is to infer functional capabilities based on structural motifs and sequence characteristics, specifically looking for signs of regulatory activity or cellular response mechanisms.

First, I examine the structural representation provided in the 3Di structural tag. The 3Di alphabet encodes local geometric states, where runs of 'V' and 'L' typically indicate alpha-helical segments, while 'D', 'P', and 'A' suggest beta-strands or turns. Scanning the structure, I observe a significant prevalence of helical markers. For instance, the segment <protein_structure>V V V</protein_structure> appearing multiple times, and notably the extended run <protein_structure>V V V V V V</protein...

Next, I correlate this with the amino acid sequence in the tag. The sequence contains clusters of basic residues, such as <protein>RRLLHRE</protein> and <protein>RRDARGL</protein>, which could facilitate nucleic acid binding or protein-protein interactions necessary for signaling. The presence of hydrophobic residues like leucine and valine in the sequence, matching the structural helices, supports the formation of a stable core. The combination of a structured helical domain and flexible loop r...

To determine the appropriate Gene Ontology biological process annotations for this protein, I need to analyze the relationship between its amino acid sequence and its predicted three-dimensional structure. The core task is to infer functional capabilities based on structural motifs and sequence characteristics. First, I examine the structural representation provided in the 3Di structural tag. The sequence begins with a long stretch of various <protein_structure>D</protein_structure>, which accor...

Next, I correlate this structural framework with the amino acid sequence in the tag to identify potential functional sites. The sequence contains several regions rich in aromatic and hydrophobic residues, such as FVVFPIEYHDIWQMYKK, which likely form the core or substrate-binding pockets. I also notice clusters of charged residues that could be involved in catalysis or interaction with nucleotides. For example, the segment EALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGVMSNST...

Given the structural evidence of a globular enzyme with potential nucleotide-binding features (inferred from the alpha-helical domains and charged patches), I can narrow down the biological processes. The protein likely participates in metabolic pathways, particularly those involving nitrogenous bases or carbohydrates, as suggested by the complexity of the binding pockets. The presence of specific motifs aligns with enzymes that handle stress responses or metabolic regulation. Therefore, the ann...

Let's break down the retrosynthetic analysis for the given product.

**1. Analysis of the Product Structure** The product is a complex heteroaromatic molecule. Let's identify its key structural features: - It contains a central pyridine ring (`[c:1]1...[n:2]...`). - At position 2 of the pyridine (the carbon between the nitrogen and the ring carbon `[c:1]`), there is a substituent: `[C:28]#[C:29][Si:30]([CH3:31])([CH3:32])[CH3:33]`. This is a **trimethylsilyl (TMS)**-protected alkyne. - At position 5 of the pyridine, there is a large substituent containing a pyrid...

**2. Retrosynthetic Disconnection** The most strategic bond to disconnect is the **carbon-carbon bond between the pyridine ring and the alkyne** (specifically, the bond between `[c:1]` and `[C:28]`). - This is a classic **Sonogashira coupling** disconnection. The reaction couples a halogenated aromatic compound with a terminal alkyne in the presence of a palladium catalyst and a copper co-catalyst.

Let's break down the retrosynthetic analysis for the target molecule.

**1. Analysis of the Target Molecule** The target molecule is a biaryl system consisting of a pyridine ring and a benzene ring. - **Pyridine ring:** The SMILES `[c:1]1(-[c:7]2...)[cH:2][cH:3][cH:4][cH:5][n:6]1` indicates a pyridine ring where the carbon at position 2 (adjacent to the nitrogen) is attached to the benzene ring. The nitrogen is at position 1, and the carbon at position 2 is `[c:1]`. - **Benzene ring:** The SMILES `[c:7]2[cH:8][cH:9][cH:10][c:11]([Br:12])[cH:13]2` represents a benze...

So, the structure is **2-(3-bromophenyl)pyridine**.

Let's break down the retrosynthetic analysis for the target molecule.

**1. Analysis of the Product Structure** The product is a complex organic molecule with the following key features: - A **trifluoroacetyl** group: `[C:1](=[O:2])([C:3]([F:4])([F:5])[F:6])` - An **amine** linkage: `[NH:7]` - A **benzyl** group: `[CH2:8][c:9]1[cH:10][cH:11][cH:12][cH:13][c:14]1` - A **sulfonyl** group: `[S:15](=[O:16])(=[O:17])` - A **cyclopropyl** ring: `[CH:18]1[CH2:19][CH2:20]1`

The connectivity is: **Trifluoroacetyl** -- **Amine** -- **Benzyl** -- **Sulfonyl** -- **Cyclopropyl**.